Sequence Similarity Search (BLAST) - Help
Sequence Similarity Search in MitoFish allows you to find sequences of fish mitochondrial DNA (and their species names) similar to your query sequence. You can choose either of "complete mtDNA" or "complete + partial mtDNA" sequence databases.
Simple Search
Simple Search
provides you a simple way of finding sequences of fish mitochondrial DNA (
and their species names) similar to your query sequence.
Enter query sequence in FASTA format or plain text into the Query box.
Clicking on the Search button, you will have BLAST (Basic Local Alignment Search
Tool) search results.
Advanced Search
Advanced Search provides more detailed Search and Results View Options. Provided are selections for Filter and Expect (E value) for the Search Options, and those for Nos. of Descriptions and Alignments and Alignment View for Results View Options.
Query
- FASTA format
-
A sequence in FASTA format begins with a single-line description,
followed by lines of sequence data. The description line is
distinguished from the sequence data by a greater-than (">") symbol
in the first column. It is recommended that all lines of text be
shorter than 80 characters in length. An example sequence in FASTA
format is:>gi|532319|pir|TVFV2E|TVFV2E envelope protein ELRLRYCAPAGFALLKCNDADYDGFKTNCSNVSVVHCTNLMNTTVTTGLLLNGSYSENRT QIWQKHRTSNDSALILLNKHYNLTVTCKRPGNKTVLPVTIMAGLVFHSQKYNLRLRQAWC HFPSNWKGAWKEVKEEIVNLPKERYRGTNDPKRIFFQRQWGDPETANLWFNCHGEFFYCK MDWFLNYLNNLTVDADHNECKNTSGTKSGNKRAPGPCVQRTYVACHIRSVIIWLETISKK TYAPPREGHLECTSTVTGMTVELNYIPKNRTNVTLSPQIESIWAAELDRYKLVEITPIGF APTEVRRYTGGHERQKRVPFVXXXXXXXXXXXXXXXXXXXXXXVQSQHLLAGILQQQKNL LAAVEAQQQMLKLTIWGVK
-
Sequences are expected to be represented in the standard
IUB/IUPAC amino acid and nucleic acid codes, with these
exceptions: lower-case letters are accepted and are mapped
into upper-case; a single hyphen or dash can be used to represent
a gap of indeterminate length; and in amino acid sequences, U and *
are acceptable letters (see below). Before submitting a request,
any numerical digits in the query sequence should either be
removed or replaced by appropriate letter codes (e.g., N for
unknown nucleic acid residue or X for unknown amino acid residue).
The nucleic acid codes supported are:A --> adenosine M --> A C (amino) C --> cytidine S --> G C (strong) G --> guanine W --> A T (weak) T --> thymidine B --> G T C U --> uridine D --> G A T R --> G A (purine) H --> A C T Y --> T C (pyrimidine) V --> G C A K --> G T (keto) N --> A G C T (any) - gap of indeterminate length
Options
- Filter (Low-complexity)
- Mask off segments of the query sequence that have low compositional complexity, as determined by the SEG program of Wootton & Federhen (Computers and Chemistry, 1993) or, for BLASTN, by the DUST program of Tatusov and Lipman (in preparation). Filtering can eliminate statistically significant but biologically uninteresting reports from the blast output (e.g., hits against common acidic-, basic- or proline-rich regions), leaving the more biologically interesting regions of the query sequence available for specific matching against database sequences.
- Filtering is only applied to the query sequence (or its translation products), not to database sequences. Default filtering is DUST for BLASTN, SEG for other programs.
- It is not unusual for nothing at all to be masked by SEG, when applied to sequences in SWISS-PROT, so filtering should not be expected to always yield an effect. Furthermore, in some cases, sequences are masked in their entirety, indicating that the statistical significance of any matches reported against the unfiltered query sequence should be suspect.
- Filter (Mask for lookup table only)
- This option masks only for purposes of constructing the lookup table used by BLAST. The BLAST extensions are performed without masking. This option is still experimental and may change in the near future.
- Expect (E Value)
- The statistical significance threshold for reporting matches against database sequences; the default value is 10, such that 10 matches are expected to be found merely by chance, according to the stochastic model of Karlin and Altschul (1990). If the statistical significance ascribed to a match is greater than the EXPECT threshold, the match will not be reported. Lower EXPECT thresholds are more stringent, leading to fewer chance matches being reported. Fractional values are acceptable.
- Other Options (for BLASTN)
-
- -G
- Cost to open a gap [Integer]
default = 5 - -E
- Cost to extend a gap [Integer]
default = 2 - -q
- Penalty for a mismatch in the blast portion of run [Integer]
default = 3 - -r
- Reward for a match in the blast portion of run [Integer]
default = 1 - -e
- Expectation value (E) [Real]
default = 10.0 - -W
- Word size, default is 11 for blastn, 3 for other programs
default = 11 - -v
- Number of one-line descriptions (V) [Integer]
default = 100 - -b
- Number of alignments to show (B) [Integer]
default = 100
Results View Options
- No. of Descriptions
- Restricts the number of short descriptions of matching sequences reported to the number specified; default limit is 100 descriptions. See also EXPECT
- No. of Alignments
- Restricts database sequences to the number specified for which high-scoring segment pairs (HSPs) are reported; the default limit is 100. If more database sequences than this happen to satisfy the statistical significance threshold for reporting (see EXPECT above), only the matches ascribed the greatest statistical significance are reported.
- Alignment View
- The choice of which to use is based on personal preference. Pairwise alignment gives a good view of the quality of an individual hit. However, a flat query-anchored alignment (with identities) is a format in which identities shared by numerous sequences can be easily spotted.